DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33826 and HTA2

DIOPT Version :9

Sequence 1:NP_001027321.1 Gene:His2A:CG33826 / 3771785 FlyBaseID:FBgn0053826 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_009552.1 Gene:HTA2 / 852283 SGDID:S000000099 Length:132 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:99/127 - (77%)
Similarity:109/127 - (85%) Gaps:4/127 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAK---SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEV 62
            ||| |||||....||   |||.:|||.|||||:|||||:||||:|:|:||||||.||:||||||:
Yeast     1 MSG-GKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEI 64

  Fly    63 LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124
            ||||||||||||||||||||||||||||:||||||..||||||||||||...|||||:.|.|
Yeast    65 LELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKTA 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33826NP_001027321.1 PTZ00017 16..124 CDD:185399 88/107 (82%)
HTA2NP_009552.1 PTZ00017 18..131 CDD:185399 89/109 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I1123
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I911
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm9240
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - LDO PTHR23430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2143
SonicParanoid 1 1.000 - - X55
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.