DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33826 and HTA13

DIOPT Version :10

Sequence 1:NP_001027321.1 Gene:His2A:CG33826 / 3771785 FlyBaseID:FBgn0053826 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_188703.1 Gene:HTA13 / 821614 AraportID:AT3G20670 Length:132 Species:Arabidopsis thaliana


Alignment Length:121 Identity:92/121 - (76%)
Similarity:105/121 - (86%) Gaps:2/121 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK--GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL 63
            |:||||  |..|..|:.|||::||||||||||.|.|:.|.||.|||||||||||||:||||||||
plant     1 MAGRGKTLGSGVAKKSTSRSSKAGLQFPVGRIARFLKNGKYATRVGAGAPVYLAAVLEYLAAEVL 65

  Fly    64 ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK 119
            |||||||||||||||:|||:|||:||||||:|||..||||.|||:|||.::|||||
plant    66 ELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHSLLLPKK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33826NP_001027321.1 PTZ00017 16..124 CDD:185399 84/104 (81%)
HTA13NP_188703.1 PLN00157 1..132 CDD:177758 92/121 (76%)

Return to query results.
Submit another query.