DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33826 and H2ac7

DIOPT Version :10

Sequence 1:NP_001027321.1 Gene:His2A:CG33826 / 3771785 FlyBaseID:FBgn0053826 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_835495.1 Gene:H2ac7 / 319165 MGIID:2448289 Length:130 Species:Mus musculus


Alignment Length:56 Identity:11/56 - (19%)
Similarity:24/56 - (42%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   571 LEEEMRRCLDRGAPGNSYSGTDSLPSRHSQARESVNGQKAPFATLCEQVGLQKILQ 626
            ||.:::..|:|.:..........|..:.|.||..:..::..|.|....:|.:.:.:
Mouse    38 LEADLQTALERVSRAPGLQQVFGLMGKRSSARSQITRRRQKFQTFVGLMGKRNVAE 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33826NP_001027321.1 PTZ00017 16..124 CDD:185399
H2ac7NP_835495.1 PTZ00017 1..130 CDD:185399 11/56 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.