DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33631 and CG33630

DIOPT Version :9

Sequence 1:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster


Alignment Length:158 Identity:75/158 - (47%)
Similarity:107/158 - (67%) Gaps:3/158 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QKPILRIHHINIFGDSRFMKALSYIDETRLKFTIFISLREELGSNFLTFNIKIRVRPTGRTNFVT 100
            :|.::.|..|::||:|.:|||..||.|.|..|.:.:.|..|||||.|..|||:||:|.|...||.
  Fly    34 KKAVVAIKQIHVFGESNYMKAKIYIHEDRSHFDLHVQLVHELGSNHLIMNIKVRVKPEGSNAFVQ 98

  Fly   101 LLQMRDLDLCGFFTEFRKNPMMKYFLQSEMQLSDIIVCPVRVGNYSVKNVSV-KDIYPQVLQNGI 164
            |.::|.::.|.|.:|:..||||:...:..::|:|||||||||||||:.|..: ::|:...:|||.
  Fly    99 LFELRRINFCEFLSEYNTNPMMEMMFKKNVKLNDIIVCPVRVGNYSLLNSDIAENIHADGVQNGT 163

  Fly   165 YKFFVEVIEATAE--KVFALQVTTEVRI 190
            |:||.|::|...|  ||||||||:||.|
  Fly   164 YRFFAEIVEEIGEIAKVFALQVTSEVYI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33631NP_001027167.1 DUF1091 84..167 CDD:284008 38/83 (46%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 42/89 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C4BM
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019989
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.