DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33631 and CG33679

DIOPT Version :9

Sequence 1:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:156 Identity:33/156 - (21%)
Similarity:63/156 - (40%) Gaps:25/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 YIDETRLK-------FTIFISLR-EELGSNFLTFNIKIRV--RPTGR--TNFVTLLQMRDL---- 107
            |:..|.||       |.:|...| :.||...:..||.:::  .|..|  ..|:|..::...    
  Fly    18 YVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRFITYRKLNGYHPFL 82

  Fly   108 -----DLCGFFTEFRKNPMMKYFLQSEMQLSDI-IVCPVRVGNYSVKNVSVKD-IYPQV-LQNGI 164
                 :.|.......:..:..||..:.|..|:| ..||.....| ::|.::.| ::.:| |..|.
  Fly    83 FNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDIY-IRNCTLDDRMFAKVPLPKGS 146

  Fly   165 YKFFVEVIEATAEKVFALQVTTEVRI 190
            ||..:|:.:.....:..:.:..|:.:
  Fly   147 YKLTLEMDDGVVNWISIINIHFEIDV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33631NP_001027167.1 DUF1091 84..167 CDD:284008 21/98 (21%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 16/79 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.