powered by:
Protein Alignment CG33631 and CG33912
DIOPT Version :9
Sequence 1: | NP_001027167.1 |
Gene: | CG33631 / 3771784 |
FlyBaseID: | FBgn0053631 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027139.1 |
Gene: | CG33912 / 3772438 |
FlyBaseID: | FBgn0053912 |
Length: | 165 |
Species: | Drosophila melanogaster |
Alignment Length: | 75 |
Identity: | 20/75 - (26%) |
Similarity: | 34/75 - (45%) |
Gaps: | 9/75 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 IKIRVRPTGR-TNFVTLLQMRDLDLCGFFTEFRKNPMMKYFLQSEMQLSDIIVCPVRVGNYSVKN 149
:|||.....| |.:...|....||.|.|......||:..:|: :.||:: .::..:||.|
Fly 72 VKIRFGLYKRFTGYKPFLYNATLDACKFLKSPNSNPVALFFI-----IHDIVL--DKMSYHSVNN 129
Fly 150 VSVKDI-YPQ 158
...|.: :|:
Fly 130 KLTKILPFPE 139
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.