DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33631 and CG33758

DIOPT Version :9

Sequence 1:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:195 Identity:42/195 - (21%)
Similarity:71/195 - (36%) Gaps:61/195 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFFPLFYIVNGNGTD--------HKSLWDDDEDNEVQKPILRIHHINIFGDSRFMKALSYIDETR 64
            :||.|..:.:   |:        |.:.:|.|                 ||:....| |..|...|
  Fly     5 LFFTLLVLTS---TEVEAKFKSLHCAAFDQD-----------------FGEFLLCK-LKAISRLR 48

  Fly    65 LKFTIFISLREELGSNFLTFNIKIRVRPTGRTNFVTLLQMRDLDLCGFFTEFRKNPMMKYFLQSE 129
            ...::...|::.:...|:  .::...|..|...|   |.....:||.|..  |.|.::       
  Fly    49 NSISVQYKLKQPVSKIFI--RLEFFKRANGWRPF---LYNFTANLCDFLA--RNNNVI------- 99

  Fly   130 MQLSDIIVCPVRVGNYS-----VKN--VSVKDIYPQV--LQNGIYKFFVEVIEATAEKVFALQVT 185
            |.:....:.|..|.|||     ::|  :..||....:  |:|   :|.:|..|      :|||:|
  Fly   100 MGIGYAYLRPYLVKNYSCPFKVIENELLECKDFELDINNLRN---RFPIETGE------YALQLT 155

  Fly   186  185
              Fly   156  155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33631NP_001027167.1 DUF1091 84..167 CDD:284008 20/91 (22%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.