DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33631 and CG33792

DIOPT Version :10

Sequence 1:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:131 Identity:30/131 - (22%)
Similarity:54/131 - (41%) Gaps:44/131 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 INIFGDSRFMKALSYIDETRLKFTIFISLREELGSN-FLTFNIKIRVRPTGRTNFVTLLQMRDLD 108
            :|:.||.:  :||     |.:|.::.:..::  .|| :..|.:|.:                 .|
  Fly    62 LNMDGDIK--EAL-----TDIKMSVEVFYKD--SSNLYKPFAVKFK-----------------FD 100

  Fly   109 LCGFFTEFRKNPMMKYFLQSEMQLSDII-------VCPVRVGNYSVKNVSVKDIYPQVLQNGIYK 166
            :|    :..||.....||| :..:|.:.       .||.|| :..:.|: ||  :.|.::. ||.
  Fly   101 VC----QLLKNKTQSNFLQ-KYAISHLTEWTNVNHSCPYRV-SLCIYNI-VK--FSQYIEY-IYM 155

  Fly   167 F 167
            |
  Fly   156 F 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33631NP_001027167.1 DUF1091 84..167 CDD:461928 20/89 (22%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 23/104 (22%)

Return to query results.
Submit another query.