DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33631 and CG33752

DIOPT Version :10

Sequence 1:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:197 Identity:42/197 - (21%)
Similarity:80/197 - (40%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFVRLSIFFPLFYIVNGNG---TDHKSLWDDDEDNE-VQKPILRIHHI--NIFGDSRFMKALSY 59
            |:|:.:.:|..:...:..||   |.|.::..:..|.. .:.|:.:::.:  .|..:|.:||.|..
  Fly     1 MRFIIIRVFCTITLSLEINGESITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKL 65

  Fly    60 -IDETRLKFTIFISLREELGSNFLTFNIKIRVRPTGRTNFVTLLQMRDLDLCGFFTEFRKNPM-- 121
             |.:..:.||::..|.   |.:...||:.:                   |.|.:..  ..|||  
  Fly    66 PIKKISVNFTVYKKLS---GYHPFLFNVTV-------------------DFCHYMK--HPNPMNI 106

  Fly   122 MKYFLQSEMQLSDI-IVCPVRVGNYSVKNVSVKDIYPQVLQNGIYKFFVEVIEATAEKVFALQVT 185
            ..||..:....|:. ..||..|.. |..::.|||.   ||.:   ..|.::...|...:|::::.
  Fly   107 FHYFYTAVKPYSNFNHSCPYNVSE-SYHDILVKDF---VLTD---TMFAKIPLPTGNYMFSIKLA 164

  Fly   186 TE 187
            |:
  Fly   165 TD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33631NP_001027167.1 DUF1091 84..167 CDD:461928 19/85 (22%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:461928 25/117 (21%)

Return to query results.
Submit another query.