DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33631 and CG33463

DIOPT Version :10

Sequence 1:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:85 Identity:18/85 - (21%)
Similarity:36/85 - (42%) Gaps:23/85 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LDLCGFFTEFRKNPMMKYFLQSEMQLSDI-IVCPVRVGNYSV--KNVSVKDIY---------PQ- 158
            :|.|......:.:|:..||..:..:.|:: ..||.   |:.:  ..::.|.:|         |: 
  Fly    93 VDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPF---NHDIILDKLTAKSVYHRMTNILPFPEG 154

  Fly   159 --VLQ-----NGIYKFFVEV 171
              :||     :|||:...:|
  Fly   155 DYMLQLNWFTSGIYRVIFKV 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33631NP_001027167.1 DUF1091 84..167 CDD:461928 17/79 (22%)
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 12/67 (18%)

Return to query results.
Submit another query.