DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33631 and LOC11175706

DIOPT Version :10

Sequence 1:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_003436199.2 Gene:LOC11175706 / 11175706 VectorBaseID:AGAMI1_012528 Length:203 Species:Anopheles gambiae


Alignment Length:37 Identity:8/37 - (21%)
Similarity:19/37 - (51%) Gaps:1/37 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 KDIYPQVLQNGIYKFFVEVIEATAEKVFALQVTTEVR 189
            |.:.| .|.:|.|:..:.:.::...::..:|:...||
Mosquito   162 KHVLP-TLPSGDYRMDIYLRDSADIELLVVQLFASVR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33631NP_001027167.1 DUF1091 84..167 CDD:461928 5/13 (38%)
LOC11175706XP_003436199.2 None

Return to query results.
Submit another query.