DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33823 and LOC100910554

DIOPT Version :9

Sequence 1:NP_001027316.1 Gene:His2A:CG33823 / 3771783 FlyBaseID:FBgn0053823 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_003751759.1 Gene:LOC100910554 / 100910554 RGDID:6497956 Length:130 Species:Rattus norvegicus


Alignment Length:122 Identity:109/122 - (89%)
Similarity:116/122 - (95%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|||:||:||||||||||:|||||||:|:||||||||||||||||||.||:||
  Rat     1 MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGSYSERVGAGAPVYLAAVMEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121
            |||||||||||||||||||||||||||||||||..||||||||||||||||||||||
  Rat    66 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33823NP_001027316.1 PTZ00017 16..124 CDD:185399 97/106 (92%)
LOC100910554XP_003751759.1 PTZ00017 1..130 CDD:185399 109/122 (89%)
H2A 6..120 CDD:238029 100/113 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4453
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3480
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm9107
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - O PTHR23430
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X55
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.