DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33823 and h2ax

DIOPT Version :9

Sequence 1:NP_001027316.1 Gene:His2A:CG33823 / 3771783 FlyBaseID:FBgn0053823 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_002935049.1 Gene:h2ax / 100487455 XenbaseID:XB-GENE-22066185 Length:139 Species:Xenopus tropicalis


Alignment Length:125 Identity:106/125 - (84%)
Similarity:114/125 - (91%) Gaps:1/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKG-GKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            ||||||. .|.:.|||:||:||||||||||:||||||||||||||||||||||||:|||.||:||
 Frog     1 MSGRGKAVSKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124
            ||||||||||||||||||||||:||||||||||..||||||||||||||||||||:...|
 Frog    66 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKSSSTA 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33823NP_001027316.1 PTZ00017 16..124 CDD:185399 95/107 (89%)
h2axXP_002935049.1 PTZ00017 1..132 CDD:185399 106/125 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4537
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3472
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm9526
Panther 1 1.100 - - LDO PTHR23430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2143
SonicParanoid 1 1.000 - - X55
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.