DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18003 and CARNS1

DIOPT Version :9

Sequence 1:NP_001027401.1 Gene:CG18003 / 3771779 FlyBaseID:FBgn0061356 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_016873543.1 Gene:CARNS1 / 57571 HGNCID:29268 Length:966 Species:Homo sapiens


Alignment Length:285 Identity:59/285 - (20%)
Similarity:92/285 - (32%) Gaps:89/285 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SGAGEQFTLGLNR-EAFRRLRLRPRCLRDVSRLDISTKIFG----EQMQWPLGIAPTAMQKMAHP 86
            ||...|.||.... |||    ||...|.|:  |.::.|:.|    .:..|.|           ||
Human   273 SGKEGQETLVKEEVEAF----LRSEALGDI--LQVAVKLSGWRWRGRQAWRL-----------HP 320

  Fly    87 DGEVGNA--------RAAGKAGSIFILSTLSTTSL--EDLAAGAPDTIKWFQLYIYK---DRTIT 138
            ..|:|..        ....:..|:.:.:......|  .|..:..|.........:.:   ||.:.
Human   321 RAELGAVVDTVLALLEKLEEEESVLVEAVYPPAQLPCSDGPSPGPGLAVRICAVVCRTQGDRPLL 385

  Fly   139 EKLVRRAEKANFKALVLTIDAPIFGHRRAD--VRNNFSLPSHLSLANFQGVKATGVGNAAMGASG 201
            .|:|                   .|..|.|  :|::.|||..|.:|..|    .|:|..|..|: 
Human   386 SKVV-------------------CGVGRGDRPLRHHNSLPRTLEVALAQ----CGLGEEAQVAA- 426

  Fly   202 INEYVSSQFDPTITWKDIAWLKGITHLPIVVKGVLTAEDAVLAQEFGCAGLIVSNHGARQIDTVP 266
            :.:.|.:..:..:.                         ||||.|   |||.....|.|:..|..
Human   427 VRQRVKAAAEAALA-------------------------AVLALE---AGLSAEQRGGRRAHTDF 463

  Fly   267 ASIEALPEIVKAVGDNLVVMLDGGI 291
            ..::........|...:.:.|:||:
Human   464 LGVDFALTAAGGVLTPVALELNGGL 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18003NP_001027401.1 alpha_hydroxyacid_oxid_FMN 7..353 CDD:239203 59/285 (21%)
FMN_dh 17..359 CDD:279418 59/285 (21%)
CARNS1XP_016873543.1 ATP-grasp_4 663..838 CDD:290269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140697
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.