DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18003 and HAO2

DIOPT Version :9

Sequence 1:NP_001027401.1 Gene:CG18003 / 3771779 FlyBaseID:FBgn0061356 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_016856910.1 Gene:HAO2 / 51179 HGNCID:4810 Length:420 Species:Homo sapiens


Alignment Length:353 Identity:159/353 - (45%)
Similarity:219/353 - (62%) Gaps:18/353 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALVCVEDFEKKAVGQLEKNALDYYRSGAGEQFTLGLNREAFRRLRLRPRCLRDVSRLDISTKIF 65
            |:|||:.||:..|..||.|:..|:...||.:..|...|..||:|:|||||.|||||.:|..|.|.
Human    14 MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQ 78

  Fly    66 GEQMQWPLGIAPTAMQKMAHPDGEVGNARAAGKAGSIFILSTLSTTSLEDLAAGAPDTIKWFQLY 130
            ||::..|:.||||....:..||||:..||||..||..:|.||.::.||||:...||:.::|||||
Human    79 GEEISAPICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLY 143

  Fly   131 IYKDRTITEKLVRRAEKANFKALVLTIDAPIFGHRRADVRNNFSLPSHLSLANFQGVKATGVGNA 195
            ::.|..:.::|::|.|...|||||:|:|.|:.|:||.|:||  .|..:|:|.:.|..|.   |||
Human   144 VHPDLQLNKQLIQRVESLGFKALVITLDTPVCGNRRHDIRN--QLRRNLTLTDLQSPKK---GNA 203

  Fly   196 AMGASGINEYVSSQFDPTITWKDIAWLKGITHLPIVVKGVLTAEDAVLAQEFGCAGLIVSNHGAR 260
                  |..:..:....::.|.|::|.:.||.|||::||:||.|||.||.:....|:||||||.|
Human   204 ------IPYFQMTPISTSLCWNDLSWFQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGR 262

  Fly   261 QIDTVPASIEALPEIVKAVGDNLVVMLDGGIMQGNDIFKALALGAKTVFVGRPAVWGLAYNGQKG 325
            |:|.|.|||:||.|:|.||...:.|.||||:..|||:.||||||||.:|:|||.:||||.   |.
Human   263 QLDEVLASIDALTEVVAAVKGKIEVYLDGGVRTGNDVLKALALGAKCIFLGRPILWGLAC---KA 324

  Fly   326 VEEMLSVLRKDFETTMALIGCQNLGDIT 353
            ....|    :..||..:..||:..|.||
Human   325 AGRSL----RSIETWSSFPGCKKKGPIT 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18003NP_001027401.1 alpha_hydroxyacid_oxid_FMN 7..353 CDD:239203 153/345 (44%)
FMN_dh 17..359 CDD:279418 151/337 (45%)
HAO2XP_016856910.1 alpha_hydroxyacid_oxid_FMN 21..326 CDD:239203 147/318 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54906
OrthoDB 1 1.010 - - D500918at33208
OrthoFinder 1 1.000 - - FOG0001123
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100930
Panther 1 1.100 - - O PTHR10578
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1926
SonicParanoid 1 1.000 - - X693
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.