DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18003 and Carns1

DIOPT Version :9

Sequence 1:NP_001027401.1 Gene:CG18003 / 3771779 FlyBaseID:FBgn0061356 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_003749079.1 Gene:Carns1 / 309150 RGDID:1308234 Length:951 Species:Rattus norvegicus


Alignment Length:339 Identity:61/339 - (17%)
Similarity:113/339 - (33%) Gaps:111/339 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YYRSGAGEQFTLGLNREA---FRRLRLRPRCLRDVSRLDISTKIFGEQMQWPL----GIA-PTAM 80
            |:.:|.|.:|  |.::||   .|.|........:::|| :..::.   |:|.|    |:| |..:
  Rat   175 YFLAGLGPEF--GHSKEAAELARHLTCPTGGSSELARL-LEDRLL---MRWLLSQQSGVAVPATL 233

  Fly    81 QKMAHPDGEVGN---------ARAAGKAGSIFILSTLSTTSLEDLAAGAPDTI-------KW--- 126
            .....|.|.:..         ...:||.|...::.......:...|.|....:       :|   
  Rat   234 AFTYRPPGLLRGGDTSPGLRLVELSGKEGQETLVKEEVEAFVHSKALGDASQVAVRLSGWRWRGQ 298

  Fly   127 --FQLYIYKD-RTITEKLVRRAEKANFKALVLTI------------------------------- 157
              ..|::.:: .|:...::...||...:..||..                               
  Rat   299 QVLPLHLQEEPSTVVNTVLGLLEKLEEEESVLVEAMCPPVRLPLPGSPAPGPELAVRICAVVCRI 363

  Fly   158 --DAPIF-----GHRRAD--VRNNFSLPSHLSLANFQGVKATGVGNAAMGASGINEYVSSQFDPT 213
              |.|:.     |..|.|  ||::::||..|.:              |:...|:.|.        
  Rat   364 QGDRPLLSKVVCGVGRGDQPVRHHYTLPRSLGV--------------ALAQCGLEEE-------- 406

  Fly   214 ITWKDIAWLKGITHLPIVVKGVLTAEDAVLAQEFGC-AGLIVSNHGARQIDTVPASIEALPEIVK 277
                        ..:.::.:|:..|.:|.||..... |||.|...|.||:.|....::.:..:|.
  Rat   407 ------------AQVALLEQGIKEAAEAALAAVLALEAGLSVEQRGGRQVHTDFLGVDFVLTVVG 459

  Fly   278 AVGDNLVVMLDGGI 291
            .....:|:.|:.|:
  Rat   460 RTLTPVVLKLNSGL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18003NP_001027401.1 alpha_hydroxyacid_oxid_FMN 7..353 CDD:239203 61/339 (18%)
FMN_dh 17..359 CDD:279418 61/339 (18%)
Carns1XP_003749079.1 ATP-grasp_4 624..823 CDD:290269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.