DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33815 and CSE4

DIOPT Version :9

Sequence 1:NP_001027303.1 Gene:His3:CG33815 / 3771771 FlyBaseID:FBgn0053815 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_012875.2 Gene:CSE4 / 853817 SGDID:S000001532 Length:229 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:69/120 - (57%)
Similarity:85/120 - (70%) Gaps:16/120 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT- 81
            |||...:..:|             |.|..:||.|||:||:||:|||.|:||.|||:|:..:|.| 
Yeast   121 RKQSLKRVEKK-------------YTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTK 172

  Fly    82 --DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 134
              |||:||.|:||||||||||||||.|.|||.|:||||:|||.||:||||||||:
Yeast   173 DQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33815NP_001027303.1 PTZ00018 1..136 CDD:185400 69/120 (58%)
CSE4NP_012875.2 H3 124..229 CDD:128705 66/117 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.