DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33815 and h3f3b

DIOPT Version :10

Sequence 1:NP_001027303.1 Gene:His3:CG33815 / 3771771 FlyBaseID:FBgn0053815 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_989026.1 Gene:h3f3b / 394622 -ID:- Length:136 Species:Xenopus tropicalis


Alignment Length:138 Identity:31/138 - (22%)
Similarity:55/138 - (39%) Gaps:14/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 NIPYQSGGPQMGSPNFSPFPNLQPQLPSMHHGSPQHTGNRPQFRPALPLNNLPPAQWMNRQNMHP 281
            |.|.::..|:..:.| |.....:||.|:.....|..| .:|:..|.:......|........|..
 Frog   865 NKPEETAKPKDRATN-SKATTPKPQKPTKAPKKPTST-KKPKTMPRVRKPKTTPTPRKMTSTMPE 927

  Fly   282 GDSSGIMNNAMLQ------QPPHQNGL-MPPQMQ---GSQNRLPHPMQPPLGHMPGMQPQLFNSH 336
            .:.:..:..||||      |.|:...: :.|:.:   |::...||.:..|...||.:.|.:  .:
 Frog   928 LNPTSRIAEAMLQTTTRPNQTPNSKLVEVNPKSEDAGGAEGETPHMLLRPHVFMPEVTPDM--DY 990

  Fly   337 LSRSSSSG 344
            |.|..:.|
 Frog   991 LPRVPNQG 998

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33815NP_001027303.1 PTZ00018 1..136 CDD:185400
h3f3bNP_989026.1 PTZ00018 1..136 CDD:185400
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.