DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33703 and CG14456

DIOPT Version :10

Sequence 1:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:127 Identity:30/127 - (23%)
Similarity:50/127 - (39%) Gaps:45/127 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YVSEVFLY--KDP-----------IDDIVLNLGVFRIAKNRRFQF----LNETLDYCLFSRQYLA 104
            :||...:|  .||           :.|:.:::.| ||. |::..:    ||.||:.|        
  Fly    40 FVSHKVVYDNSDPHLNFSMEVHQELHDVDIHVEV-RIT-NKQDPYYNTNLNTTLNVC-------- 94

  Fly   105 SGFFGFLMTPLLRISNLNATCPLQQNITFNGFSVDE--NTIKEIPIPNGVYMFHLRSSLMKK 164
                        ||.......|:.:.:  :|| :.|  |.::..||..|.|.:| |..|.:|
  Fly    95 ------------RILGFANKSPVGRFV--HGF-IREFGNIVETCPIAKGRYHWH-RIHLKRK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33703NP_001027119.1 DUF1091 73..155 CDD:461928 20/87 (23%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 20/83 (24%)

Return to query results.
Submit another query.