DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33703 and CG13561

DIOPT Version :10

Sequence 1:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:189 Identity:47/189 - (24%)
Similarity:71/189 - (37%) Gaps:44/189 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LSLVLPLLIILDCSQGRVFRVSKMECRSLDPSFTYFKTCKVVRRENGRAALYVSEVFLYKDPIDD 70
            |.|:..|..||.. || |.:.:.:||.|.|.:||....|:               ::..|..:.:
  Fly     7 LFLLFGLWHILQV-QG-VAKFTNIECLSADENFTTVSLCR---------------LYAVKRDVVE 54

  Fly    71 IVLNLGVFRIAK---NRRFQFLNETLDYCLFSR--------QYLAS---GFFGFLMTPLLRISNL 121
            :.|...:.|..|   :.|.|.|.:...|..|..        :||..   .|...:::.....:|:
  Fly    55 MSLRANILRWPKGPVSMRMQLLKKASGYKPFLYNICQSDVCEYLEKRNHPFINIILSSFGNRTNV 119

  Fly   122 NATCPLQQNITFNGFSVDENTIKEIPIPNGVY------MFHLRSSLMKKWRTDVKVYAT 174
            | .||:...|....|......:..:|:|.|.|      .|| ||.|     ..||||.|
  Fly   120 N-KCPIPPEIVLEHFRFPVKVLDMMPLPFGDYGLFTTFTFH-RSEL-----AQVKVYFT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33703NP_001027119.1 DUF1091 73..155 CDD:461928 21/101 (21%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 25/97 (26%)

Return to query results.
Submit another query.