DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33703 and CG33640

DIOPT Version :9

Sequence 1:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster


Alignment Length:151 Identity:29/151 - (19%)
Similarity:62/151 - (41%) Gaps:12/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SLDPSFTYFKTCKVVRRENGRAALYVSEVFLYKDPIDDIVLNLGVFRIAKNRR--FQFLNETLDY 95
            ::|....:.....||.::..|:  |:|...:....::|:.|...: .|.:.:|  .:..|..|::
  Fly    32 TVDDRDLFLSQSAVVEQDGNRS--YLSGHMMINRLVNDLTLTSSM-DITRPQRPELRLYNVQLNF 93

  Fly    96 CLFSRQYLASGFFGFLMTPLLRISNLNATCPLQQNITF--NGFSVDENTIKEIPIPNGVY----M 154
            |........:.|...|.....:..|....|||:.|..:  :...:||..:.:: :|...|    .
  Fly    94 CSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYIDEAMLPDL-LPECTYRLKMS 157

  Fly   155 FHLRSSLMKKWRTDVKVYATR 175
            |..:|.|:...:.|.::.:.|
  Fly   158 FKHKSKLLAHMQIDGRLLSKR 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 17/89 (19%)
CG33640NP_001027255.2 DUF1091 73..154 CDD:284008 16/82 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.