DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33703 and CG33630

DIOPT Version :9

Sequence 1:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster


Alignment Length:139 Identity:26/139 - (18%)
Similarity:59/139 - (42%) Gaps:17/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RAALYVSEVFLYKDPIDDIVLNLGVFRIAKNRRFQ------------FLNETLDYCLFSRQYLAS 105
            :|.:|:.|...:.|....:|..||...:..|.:.:            |....:::|.|..:|..:
  Fly    53 KAKIYIHEDRSHFDLHVQLVHELGSNHLIMNIKVRVKPEGSNAFVQLFELRRINFCEFLSEYNTN 117

  Fly   106 GFFGFLMTPLLRISNLNATCPLQ-QNITFNGFSVDENTIKEIPIPNGVYMFHLRSSLMKKWRTDV 169
            .....:....:::::: ..||:: .|.:.....:.|| |....:.||.|.|.  :.::::.....
  Fly   118 PMMEMMFKKNVKLNDI-IVCPVRVGNYSLLNSDIAEN-IHADGVQNGTYRFF--AEIVEEIGEIA 178

  Fly   170 KVYATRVNN 178
            ||:|.:|.:
  Fly   179 KVFALQVTS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 16/94 (17%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 17/93 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.