DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33703 and CG33928

DIOPT Version :9

Sequence 1:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:149 Identity:41/149 - (27%)
Similarity:68/149 - (45%) Gaps:15/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKMECRSLDPSFTYFKTCKVVRRENGRAALYVS-EVFLYKDPIDDIVLNLGVFRIAKNRRFQF-L 89
            :.::|.|:|..|:.|:.|.:  :...|...|:| :|.|||.|:....:|||:.: ..|....| .
  Fly    30 TNIKCTSMDKKFSDFEYCFL--KATNRTYKYLSVKVRLYKIPVHHFTVNLGLHK-RSNGLMPFNQ 91

  Fly    90 NETLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPLQQNITFNGFS---VDENTIKEIPIPNG 151
            |.|.|.|..... :.:....||.......||:|.:||...:|..:...   |::...|.:|:|.|
  Fly    92 NFTFDGCKMVAN-VGNPMVLFLFALFKPYSNINHSCPYTHDIIVDKLPTHFVNQQFTKYVPLPEG 155

  Fly   152 VYMFHLRSSLMKKWRTDVK 170
            .|:|:      ..|.|:.|
  Fly   156 DYVFN------SNWFTNGK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 23/85 (27%)
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.