DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33703 and CG33687

DIOPT Version :9

Sequence 1:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster


Alignment Length:160 Identity:41/160 - (25%)
Similarity:76/160 - (47%) Gaps:28/160 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKMECRSLDPSFTYFKTCKVVRRENGRAALYVS-EVFLYKDPIDDIVLNLGVFRIAKNRRFQFLN 90
            :.::|..:|.:|..|:.|::  :...|...|:. .:.||..||::|::.|...|.....|..|::
  Fly    15 TNLKCEMIDRTFGNFEMCRI--KAVNRTHKYIDINLKLYILPINNIMIKLDSKRYTNGYRPFFMS 77

  Fly    91 ETLDYCLFSRQYLASG------FFGFLMTPLLRISNLNATCPLQQNITFNGF---SVDENTIKEI 146
            .|.|:|    :||.:.      |...:.:..:..||||.|||...:||.|.|   :::...::.:
  Fly    78 LTFDFC----KYLKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDITVNKFWTGNLERAFLRYL 138

  Fly   147 PIPNGVYMFHLRSSLMKKWRTDVKVYATRV 176
            |:|||.|      ::...|      |::.|
  Fly   139 PVPNGDY------AIFSTW------YSSNV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 26/90 (29%)
CG33687NP_001027130.2 DUF1091 64..147 CDD:284008 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.