DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33703 and CG33463

DIOPT Version :10

Sequence 1:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:180 Identity:40/180 - (22%)
Similarity:74/180 - (41%) Gaps:18/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LSLVLPLLIILDCSQ--GRVFRVSKMECRSLDPSFTYFKTCKVVRRENGRAALYVS-EVFLYKDP 67
            |||:|.|.:.:..:.  ..:.....:.|.::|..|:.|:.|.:  :...|...|:| ::.|.:.|
  Fly     5 LSLLLTLWLAMQLASKTTAMLEFKNINCEAVDKEFSEFEYCYL--KSVNRTYKYISVKLKLLQLP 67

  Fly    68 IDDIVLNLGVFRIAKNRRFQFLNETLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPLQQNIT 132
            :.:..:|..:|:.....:....|.|:|.|...:....|....:........||:|.:||...:|.
  Fly    68 VTNAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDII 132

  Fly   133 FNGFSVDENTIKEI--------PIPNGVYMFHLRSSLMKKWRTDVKVYAT 174
                 :|:.|.|.:        |.|.|.||..|.......:|...||:.:
  Fly   133 -----LDKLTAKSVYHRMTNILPFPEGDYMLQLNWFTSGIYRVIFKVFVS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33703NP_001027119.1 DUF1091 73..155 CDD:461928 20/89 (22%)
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 20/89 (22%)

Return to query results.
Submit another query.