DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33703 and CG33483

DIOPT Version :10

Sequence 1:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:160 Identity:42/160 - (26%)
Similarity:69/160 - (43%) Gaps:28/160 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKMECRSLDPSFTYFKTCKVVRRENGRAALYVS-EVFLYKDPIDDIVLNLGVFRIAKNRRFQ--- 87
            :.::|.|.|.:|..|:.|.:  :...|:..|:| :|.|:|.||..:.:|..:.     :||.   
  Fly    78 TNIKCTSWDKAFDDFEYCHL--KSVNRSFKYLSLKVNLHKVPITKVKVNFSLL-----KRFNGYK 135

  Fly    88 -FL-NETLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPLQQNITFNGFS---VDENTIKEIP 147
             || |.|:|.|...|....:..|.|........||:|.|||...::......   :::....:|.
  Fly   136 PFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIK 200

  Fly   148 IPNGVYMFHLRSSLMKKWRTDVKVYATRVN 177
            .|:|.|:||      ..|      ||..:|
  Fly   201 FPHGDYLFH------SDW------YAYGIN 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33703NP_001027119.1 DUF1091 73..155 CDD:461928 22/89 (25%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:461928 22/89 (25%)

Return to query results.
Submit another query.