DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10097 and FAR8

DIOPT Version :9

Sequence 1:NP_001027182.1 Gene:CG10097 / 3771756 FlyBaseID:FBgn0038033 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_190042.2 Gene:FAR8 / 823581 AraportID:AT3G44560 Length:496 Species:Arabidopsis thaliana


Alignment Length:496 Identity:135/496 - (27%)
Similarity:227/496 - (45%) Gaps:73/496 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSEIISFYKDKTVFITGGTGLLGKVVVEKLLRA-TDVKRIYFLVRTKRGEKMEARF--ESWKKD 62
            |....:.|.::||:.:||.||.|.||.|||:||. .:|.::|.:||....|....|.  |:::||
plant     1 MEFSCVHFLQNKTILVTGATGFLAKVFVEKILRVQPNVNKLYLVVRASDNEAATKRLRTEAFEKD 65

  Fly    63 QVFEVLLNK------NPLALEKMTPISGDCCAPDLGISETD-RRILAAEVQVLIHGAASVRFEEP 120
             :|:||.:.      |.|..||:.|::||.....||:.::: |..:..|:.::::.||:..|:|.
plant    66 -LFKVLRDNLGDEKLNTLLSEKVVPVAGDIAMDHLGMKDSNLRERMQKEIDIVVNVAATTNFDER 129

  Fly   121 LEHAVVINTRAVRLITQLAKEMRLLESFVHVSTAFSNC------------VVDQI---------- 163
            .:..:.|||.....:...||:....:..:|||||:. |            |:::|          
plant   130 YDIGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYV-CGEKPGLLPEKPFVMEEICNENGLQLDI 193

  Fly   164 -QERFYPEHLSCPVDKVLDMHNSVSSETFEK----MAPALIGKFPNTYTYTKALGEQVIQEEAKG 223
             .||   |.:...:.::.:...|....||..    |..|.:..:||||.:||::||.::....:.
plant   194 NLER---ELMKQRLKELNEQGCSEEGTTFYMKELGMERAKLHGWPNTYVFTKSMGEMLLGNHKEN 255

  Fly   224 LPVGIFRPAIILSTFKEPVQGWVDGLQGLIAMIFATAYGFVHLLLVNLKVNAPIVPVDYCVNVAI 288
            ||:.|.||.:|.||..||..||::||:.:.::|.|...|.:...||::.....::|.|...|..|
plant   256 LPLVIIRPTMITSTLFEPFPGWIEGLRTVDSVIIAYGKGVLKCFLVDVNSVCDMIPADMVANAMI 320

  Fly   289 ASAVQIAKISKQNKNGPPPIYAFTPSESNLVTYEDLAGL--CY--QNGLEVPNAKMIWYPFTHCT 349
            |:|...|..||.:.     :|....|..|.:.|.::..:  ||  :|.|...|..||........
plant   321 AAAATHAGGSKVHM-----VYQVGSSHQNPIIYGEIREILFCYFTKNSLRSRNGSMITVSKMKLI 380

  Fly   350 RCPYLYNIGILFYHMLPGYLLDIV-----------LRLKGQKPMMIKSYHKVHEGMRSLLPFSRK 403
            ....|:::.:...:.||..||.:|           .:.|.:|..|:....|::|      |:...
plant   381 PTLALFSLYMTIRYKLPVQLLKLVDIIYPSREGDEYKNKNRKIDMVMRLVKLYE------PYVLF 439

  Fly   404 TFTMDMKNTNEMWQSMSPE-----EKEMFNFDMSTLNWKEY 439
            ....|.:||..:......|     |..||:||...:.||:|
plant   440 KGIFDDRNTKNLCAKQKEEDNRNSENFMFDFDPKIIKWKDY 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10097NP_001027182.1 PLN02996 1..453 CDD:215538 135/496 (27%)
FAR-N_SDR_e 12..330 CDD:187547 104/358 (29%)
Sterile 363..453 CDD:281068 23/93 (25%)
FAR8NP_190042.2 PLN02996 1..495 CDD:215538 135/496 (27%)
FAR-N_SDR_e 12..362 CDD:187547 104/359 (29%)
Sterile 394..495 CDD:281068 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 159 1.000 Domainoid score I1277
eggNOG 1 0.900 - - E1_COG3320
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I1437
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000172
OrthoInspector 1 1.000 - - mtm964
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11011
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X145
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.