DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14929 and micos13

DIOPT Version :9

Sequence 1:NP_001260386.1 Gene:CG14929 / 3771749 FlyBaseID:FBgn0032365 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001038338.1 Gene:micos13 / 558738 ZFINID:ZDB-GENE-050309-178 Length:111 Species:Danio rerio


Alignment Length:108 Identity:28/108 - (25%)
Similarity:48/108 - (44%) Gaps:10/108 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLIRLALVAGAVYGTQELGIWESSDHTKVLFEGAKREVSPYAEDLMNRFCCWRCDKCKEDVQVKP 68
            |..::.:..||:|...:.|:...|:...|....||..:.|..::.|..|        ..::...|
Zfish    11 FATKVTIAGGALYVAYDSGLLGGSNEGSVALARAKSAIPPAVDEWMKYF--------GFELPATP 67

  Fly    69 WQE-SMVDAWNETIKKTFHALGVQVPFYYKRFSEDFQQGIDDL 110
            ..| |.:||||..::|:.|||.| .|.....:::...|.:.||
Zfish    68 KIEFSPLDAWNSGVQKSIHALSV-APSTVGDYTKQGLQYVKDL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14929NP_001260386.1 QIL1 4..101 CDD:292509 25/97 (26%)
micos13NP_001038338.1 QIL1 9..100 CDD:292509 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1599526at2759
OrthoFinder 1 1.000 - - FOG0006428
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31816
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.