DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14929 and CG43328

DIOPT Version :9

Sequence 1:NP_001260386.1 Gene:CG14929 / 3771749 FlyBaseID:FBgn0032365 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001286516.1 Gene:CG43328 / 246625 FlyBaseID:FBgn0263033 Length:241 Species:Drosophila melanogaster


Alignment Length:167 Identity:37/167 - (22%)
Similarity:62/167 - (37%) Gaps:58/167 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIRLALVAGAVYG----TQELGIWESSDHTKVLFEGAKREVSPYAEDLMNRFCCWRCDKCKEDVQ 65
            ::.|.|.||.||.    |:..|:|||.:.|:.:::.....:.|||            |:.:..:.
  Fly     2 VVGLILRAGVVYAVVMVTKNYGVWESPNKTQDVYDETVERIEPYA------------DQARRKLN 54

  Fly    66 VKP--------WQESMVDAWNETIKKTFHALGV----------QVPFYYKRFSEDFQQGIDDLVN 112
            :.|        |....:..:|:.:|..|..|.|          :||.|...|:|..|:.|.:..:
  Fly    55 ICPPRPPPEGEWSFFGIYYYNKLVKSVFDLLSVFPAGLAAFLEKVPSYVNAFNETIQKYIKESQS 119

  Fly   113 EKEEI------------------------DTNAKKGP 125
            :|:||                        |.|..|.|
  Fly   120 KKKEITISKGQLDETPLVRPPGLVPPHCKDKNCPKAP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14929NP_001260386.1 QIL1 4..101 CDD:292509 27/117 (23%)
CG43328NP_001286516.1 QIL1 3..97 CDD:292509 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006428
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31816
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.