DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14929 and MICOS13

DIOPT Version :9

Sequence 1:NP_001260386.1 Gene:CG14929 / 3771749 FlyBaseID:FBgn0032365 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001295169.1 Gene:MICOS13 / 125988 HGNCID:33702 Length:140 Species:Homo sapiens


Alignment Length:103 Identity:25/103 - (24%)
Similarity:43/103 - (41%) Gaps:9/103 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLIRLALVAGAVYGTQELGIWESSDHTKVLFEGAKREVSPYAEDLMNRFCCWRCDKCKEDVQVKP 68
            |||:.::..||||...:..:...||.::...:.|...|.|    .|.:|..:.|.:....:...|
Human    33 FLIKGSVAGGAVYLVYDQELLGPSDKSQAALQKAGEVVPP----AMYQFSQYVCQQTGLQIPQLP 93

  Fly    69 WQESMV----DAWNETIKKTFHALGVQVPFYYKRFSED 102
            ....:.    |:||..|.....||.| .|...:.:|::
Human    94 APPKIYFPIRDSWNAGIMTVMSALSV-APSKAREYSKE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14929NP_001260386.1 QIL1 4..101 CDD:292509 24/100 (24%)
MICOS13NP_001295169.1 QIL1 32..129 CDD:318163 24/100 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1599526at2759
OrthoFinder 1 1.000 - - FOG0006428
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31816
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.