DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Argl and Fum3

DIOPT Version :9

Sequence 1:NP_001027234.1 Gene:Argl / 3771738 FlyBaseID:FBgn0032076 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001261710.1 Gene:Fum3 / 39281 FlyBaseID:FBgn0036162 Length:470 Species:Drosophila melanogaster


Alignment Length:355 Identity:77/355 - (21%)
Similarity:128/355 - (36%) Gaps:102/355 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGRFTEGPHEALHSL----------NNSLPYDSRL------YADDLDASKAYAEALH-------- 53
            ||.....|.:.:.::          |.....|.:|      .|||:.:.|.|.|. |        
  Fly    41 GGEEERMPRQIIQAMGILKKAAAETNQEFGLDPKLSTAISNAADDVISGKLYDEG-HFPLPIWQT 104

  Fly    54 RAGLINSAEADKLVKN--LELLRFDWIEGTVKILPGDED-VHTVNERLLVEITGELGQRLHTGRS 115
            .:|..::..:::::.|  :|||     .|.:    |.:| ||.             ...::..:|
  Fly   105 GSGTQSNMNSNEVIGNRAIELL-----GGRI----GTKDPVHP-------------NDHVNKSQS 147

  Fly   116 RND--------QVVTDMKLWLRKAIRETLGRLSGIIETATR---QAELH--LGVLMPGYTHLQRA 167
            .||        .|.|.:...||.|:            ||.|   ||:.:  ..::..|.||.|.|
  Fly   148 SNDTFPSAIHIAVATALTKDLRPAV------------TALRDSLQAKSNEWKDIIKIGRTHTQDA 200

  Fly   168 QTVQFSHWLLSHAFALREDGQRLLELRDRANVLPLGSGALAGNPLGIDRLW-------LAERLGF 225
            ..:........:|..|....||:..:..|...|.|| |...|..|...|.:       :|:..|.
  Fly   201 VPLTLGQEFSGYAQQLTNGLQRIDAVLPRVYQLALG-GTAVGTGLNTRRGFAEKCVKRIAQLSGL 264

  Fly   226 SGVTA-NSMHAVGDRDFVVDFIYCCSMVSLHLSRLAEDLIIYSTKEFDFI------KLADGF--- 280
            ..|.| |...|:..||.:|:.....:::::.|.::..|:        .|:      .|.:.|   
  Fly   265 PFVVAPNFFEALACRDAMVEVHGALNVLAVSLMKVTNDI--------RFLGSGPRCGLGELFLPE 321

  Fly   281 -SSGSSLMPQKRNPDSLELIRGMAGVITAN 309
             ..|||:||.|.||...|.:..:...:..|
  Fly   322 NEPGSSIMPGKVNPTQCEAMTMICAQVMGN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArglNP_001027234.1 PRK00855 9..460 CDD:179143 77/355 (22%)
Argininosuccinate_lyase 30..461 CDD:176463 73/328 (22%)
Fum3NP_001261710.1 fumC 8..469 CDD:234779 77/355 (22%)
Fumarase_classII 10..466 CDD:176465 77/355 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.