DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33861 and HON4

DIOPT Version :9

Sequence 1:NP_001027379.1 Gene:His1:CG33861 / 3771736 FlyBaseID:FBgn0053861 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_188431.3 Gene:HON4 / 821328 AraportID:AT3G18035 Length:480 Species:Arabidopsis thaliana


Alignment Length:263 Identity:63/263 - (23%)
Similarity:99/263 - (37%) Gaps:75/263 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKG 110
            |||..:|:.|:|..|.|..|||.:||.:||...|.......|..:..:||:...:|.|...|   
plant    65 HPPYSEMICAAIAALNEPDGSSKMAISRYIERCYTGLTSAHAALLTHHLKTLKTSGVLSMVK--- 126

  Fly   111 ASGSFKLSASAKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKK--TAVGAADK--------- 164
              .|:|::.|:    .|.| |..::|....|...|...:|..||..  .|.|:|.:         
plant   127 --KSYKIAGSS----TPPA-SVAVAAAAAAQGLDVPRSEILHSSNNDPMASGSASQPLKRGRGRP 184

  Fly   165 -KPK-------AKKAVATKKTAENKK------------------TEKAK---------------- 187
             |||       .::...|.:...|.:                  ||.||                
plant   185 PKPKPESQPQPLQQLPPTNQVQANGQPIWEQQQVQSPVPVPTPVTESAKRGPGRPRKNGSAAPAT 249

  Fly   188 ---AKDAKKTGIIK--SKPAATKAKVTAAKPKAVIAKASKAKPAVS------AKPKKTVKKASVS 241
               .:.:...||:|  .:|...:|.....|||:|.:.|| ..|.|:      .:|::.|..:|:.
plant   250 APIVQASVMAGIMKRRGRPPGRRAAGRQRKPKSVSSTAS-VYPYVANGARRRGRPRRVVDPSSIV 313

  Fly   242 ATA 244
            :.|
plant   314 SVA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33861NP_001027379.1 Linker_histone 46..118 CDD:278939 24/71 (34%)
HON4NP_188431.3 H15 64..126 CDD:197772 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.