DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33861 and HIS1-3

DIOPT Version :9

Sequence 1:NP_001027379.1 Gene:His1:CG33861 / 3771736 FlyBaseID:FBgn0053861 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_179396.1 Gene:HIS1-3 / 816317 AraportID:AT2G18050 Length:167 Species:Arabidopsis thaliana


Alignment Length:200 Identity:58/200 - (28%)
Similarity:94/200 - (47%) Gaps:44/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQK 85
            |.|:::|..:.....|.|    |.:|||..||:..::..|||:.|||..||.|.|...:|    .
plant     3 EDKILKKTPAAKKPRKPK----TTTHPPYFQMIKEALMVLKEKNGSSPYAIAKKIEEKHK----S 59

  Fly    86 LAP-----FIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAK---KEKDPKAKSKVLSAEKKVQS 142
            |.|     .:...||::|..|||::.:     .|:|||.:.|   :::|.|.|..:...:|::  
plant    60 LLPESFRKTLSLQLKNSVAKGKLVKIR-----ASYKLSDTTKMITRQQDKKNKKNMKQEDKEI-- 117

  Fly   143 KKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTGIIKSKPAATKA- 206
                       :|:|.  ::..:||       |..:.||:.:|.|.|.|::...|||.....|| 
plant   118 -----------TKRTR--SSSTRPK-------KTVSVNKQEKKRKVKKARQPKSIKSSVGKKKAM 162

  Fly   207 KVTAA 211
            |.:||
plant   163 KASAA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33861NP_001027379.1 Linker_histone 46..118 CDD:278939 26/76 (34%)
HIS1-3NP_179396.1 H15 21..87 CDD:197772 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55300
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.