DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33861 and si:dkey-23a13.17

DIOPT Version :9

Sequence 1:NP_001027379.1 Gene:His1:CG33861 / 3771736 FlyBaseID:FBgn0053861 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001373655.1 Gene:si:dkey-23a13.17 / 571135 ZFINID:ZDB-GENE-160113-52 Length:206 Species:Danio rerio


Alignment Length:239 Identity:96/239 - (40%)
Similarity:129/239 - (53%) Gaps:40/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |:::|.|.:|||..||         :|||:    :|.|||.     |..:.::..::...|||.|
Zfish     1 MAETAPAPAASPAKAP---------KKKAA----SKPKKAG-----PNVRDLIVKTVTASKERNG 47

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.::| .|  |.:|....:|..:|:.|.||.|.||||.||||||||:   ||:.:||.
Zfish    48 VSLAALKKALSAGGY--DVEKNNSRVKTAVKALVTNGTLAQTKGTGASGSFKLN---KKQAEPKK 107

  Fly   130 KSKVLSAE-KKVQSKKVASKKIGVSSKK---TAVGAADKKP-KAKKAVATKKTAENKKTEKAKAK 189
            .:|..:|: ||..:||.|:||....:||   |:|..|.|.| ||||..|.||..::.|  |||..
Zfish   108 AAKKTAAKAKKPAAKKPAAKKSPKKAKKPAATSVKKATKSPKKAKKPAAAKKATKSPK--KAKKP 170

  Fly   190 DAKKTGIIKSKPAATKAKVTAAKPKAVIAKASKAKPAVSAKPKK 233
            .|.|      |.|.:..||.|.|||....||:|.|   .|.|||
Zfish   171 AAAK------KAAKSPKKVKAVKPKTAKPKAAKPK---KAAPKK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33861NP_001027379.1 Linker_histone 46..118 CDD:278939 31/72 (43%)
si:dkey-23a13.17NP_001373655.1 Linker_histone 29..99 CDD:395429 31/71 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.