DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33861 and histh1l1

DIOPT Version :9

Sequence 1:NP_001027379.1 Gene:His1:CG33861 / 3771736 FlyBaseID:FBgn0053861 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001017660.1 Gene:histh1l1 / 550353 ZFINID:ZDB-GENE-050417-145 Length:201 Species:Danio rerio


Alignment Length:235 Identity:89/235 - (37%)
Similarity:117/235 - (49%) Gaps:40/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |:::|.|.:|:|..:|         :|||     |||||..     |....::..::....||.|
Zfish     1 MAETAPAPAAAPAKSP---------RKKA-----TKAKKPG-----PSVSDLIVKAVAASNERKG 46

  Fly    66 SSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLS--ASAKKEKDPK 128
            .||.|:||.: |....|.:|....:|..||:.|..|.|:||||.|||||||:|  |:|||    .
Zfish    47 VSLAALKKAL-AGGGYDVEKNNSRVKITLKALVKRGALVQTKGTGASGSFKVSKKAAAKK----P 106

  Fly   129 AKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAAD--KKPKAKKAVATKKTAEN-KKTEKAKAKD 190
            ||..|...:|.|..||.|:.|: ...||.||..|.  |.||..|..|.||.|:: ||.:|...| 
Zfish   107 AKKVVAKPKKPVVKKKKAAAKV-AKPKKAAVKKASPKKSPKKVKKPAAKKVAKSPKKVKKPAVK- 169

  Fly   191 AKKTGIIKSKPAATKAKVTAAKPKAVIAKASKAKPAVSAK 230
                     |.|.:..||.|.||||...||:|||...:.|
Zfish   170 ---------KVAKSPKKVKAVKPKAAKPKAAKAKKTAAKK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33861NP_001027379.1 Linker_histone 46..118 CDD:278939 29/71 (41%)
histh1l1NP_001017660.1 Linker_histone 28..95 CDD:278939 26/67 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.