DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33861 and BigH1

DIOPT Version :9

Sequence 1:NP_001027379.1 Gene:His1:CG33861 / 3771736 FlyBaseID:FBgn0053861 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster


Alignment Length:301 Identity:82/301 - (27%)
Similarity:124/301 - (41%) Gaps:75/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYI 75
            :|...||.....|:|...:........|......|      :...:|..|..|.|||:.||..|:
  Fly    70 NPYPTPPPDDGSKLVPPDSDNPKSMVPKPKGTLIS------LALMAIGKLASRSGSSVQAIMTYL 128

  Fly    76 T---ATYKCDAQKLAPFIKKYLKSAVVNGKLIQT--------KGKGASGSF-KLSASAKKEKDPK 128
            .   ..:| |.:|.|..:.:.||.|..||:::..        |.|.:|.:. |:.|..:|||:.|
  Fly   129 KDNGQEWK-DPKKTARLLHRALKLAEANGEVVMVKRSFKLTDKQKNSSKAVEKMKAKKQKEKEKK 192

  Fly   129 AK-SKVL-------SAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKK----TAENK 181
            || .|||       .|:.|::.||.:.:|   |||.|       :.|.|:||..||    |.:|.
  Fly   193 AKVEKVLKEKIQKKEAKAKMKEKKASKEK---SSKPT-------ERKTKQAVKKKKPEDGTKDNP 247

  Fly   182 KTEKAKAK-------DAKKTGIIKS--KPAATKAKV------------------TAAKPKAVIAK 219
            ...||.:.       :..:|.|.::  |||.||.|:                  |.|:|||...|
  Fly   248 PASKAASSAAAQAMLETSQTAIPEAGKKPAKTKVKLQADSSEAGKTKKSRKSIGTLAQPKAARPK 312

  Fly   220 ASKAKPAVSAK----PKKTVKKASVSATAKKPKAKTTAAKK 256
            ....|..|:.|    |..::.:|..::|   |:..|.|.:|
  Fly   313 VKAVKKLVAGKGASTPDLSIMEAQATST---PQGATKAKRK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33861NP_001027379.1 Linker_histone 46..118 CDD:278939 22/83 (27%)
BigH1NP_650383.2 H15 109..167 CDD:294056 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.