DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33861 and h1-0

DIOPT Version :9

Sequence 1:NP_001027379.1 Gene:His1:CG33861 / 3771736 FlyBaseID:FBgn0053861 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_998836.1 Gene:h1-0 / 407939 XenbaseID:XB-GENE-480028 Length:196 Species:Xenopus tropicalis


Alignment Length:230 Identity:91/230 - (39%)
Similarity:116/230 - (50%) Gaps:46/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITAT 78
            ||.||...|:   .|||       |||:   .||....|:.|:::..|.|.|||..:|:|||...
 Frog     6 AAAPAGKPKR---SKAS-------KKAT---DHPKYSDMILAAVQAEKSRSGSSRQSIQKYIKNH 57

  Fly    79 YK----CDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKK 139
            ||    .|:|     ||..:|..|.:|.|.||||.||||||:| |.|.:.|.|..|.|     |:
 Frog    58 YKVGENADSQ-----IKLSIKRLVTSGTLKQTKGVGASGSFRL-AKADEGKKPAKKPK-----KE 111

  Fly   140 VQSKKVASKKIGVSSKKTAVGAAD-KKPKAKKAVATKKTAENKKTEKAKA-KDAKKTGIIKSKPA 202
            :  ||.||.|.....||.|...|. ||||    ||.||..:..|.:.|.: |.||||..:|:|| 
 Frog   112 I--KKAASPKKAAKPKKAAKSPAKAKKPK----VAEKKVKKPAKKKPAPSPKKAKKTKTVKAKP- 169

  Fly   203 ATKAKVTAAKPKAVIAKASKAKPAVSAKPKKTVKK 237
                 |.|::.|    ||..:||...|.|||:.:|
 Frog   170 -----VRASRVK----KAKPSKPKAKASPKKSGRK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33861NP_001027379.1 Linker_histone 46..118 CDD:278939 33/75 (44%)
h1-0NP_998836.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 13/35 (37%)
Linker_histone 25..96 CDD:366156 34/76 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..196 59/140 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4781
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm9433
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.