DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33861 and hil-4

DIOPT Version :9

Sequence 1:NP_001027379.1 Gene:His1:CG33861 / 3771736 FlyBaseID:FBgn0053861 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001379704.1 Gene:hil-4 / 178866 WormBaseID:WBGene00001855 Length:253 Species:Caenorhabditis elegans


Alignment Length:266 Identity:93/266 - (34%)
Similarity:124/266 - (46%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVA-----TSASPVAAPPATVEKKVVQ-KKASGSAGTKAKKASATPSHPPTQQMVDASIKN 59
            |||.|||     |.|:|..|..||...|..: .||:.:..||.....|..:|||...||..:|.:
 Worm     1 MSDVAVAADTTETPAAPTKASKATKASKATKASKATKAKTTKVPMVKADAAHPPFINMVTEAISS 65

  Fly    60 LKERGGSSLLAIKKYITATYKC--DAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLS-ASA 121
            :|:|.|.|..||.||||..|..  .|.|:...::|.|...:.:...:|..|.||:|.|:|: .:|
 Worm    66 IKDRKGPSRAAILKYITTKYTLGDQANKINAHLRKALNKGLESNAFVQASGNGANGRFRLAEKTA 130

  Fly   122 KKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKA 186
            ...|.|.|..|..:.|||..:  ..:||.....||.....      ||||...:|.|.....:||
 Worm   131 SVAKSPAAAKKDATGEKKATT--TVAKKAATGEKKATTTV------AKKAATGEKKATTTVAKKA 187

  Fly   187 KAKD-AKKTGI----IKSKPAATKA---KVTAAKPKAVIAKASKAKPAVSAKPKKTVKKASVSAT 243
            .|.| ||||.:    :||.....|:   |||.: |...|||:|..|    |.|||...|.:..|.
 Worm   188 AAGDKAKKTEVKVKKVKSPKKIAKSPVNKVTKS-PVKKIAKSSSMK----AAPKKAAAKPAKKAP 247

  Fly   244 AKKPKA 249
            |..|:|
 Worm   248 AAAPEA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33861NP_001027379.1 Linker_histone 46..118 CDD:278939 27/73 (37%)
hil-4NP_001379704.1 Linker_histone 52..126 CDD:395429 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I6615
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I3461
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55300
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm4774
orthoMCL 1 0.900 - - OOG6_110754
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.