DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33861 and LOC101732876

DIOPT Version :9

Sequence 1:NP_001027379.1 Gene:His1:CG33861 / 3771736 FlyBaseID:FBgn0053861 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_004912081.2 Gene:LOC101732876 / 101732876 -ID:- Length:224 Species:Xenopus tropicalis


Alignment Length:242 Identity:98/242 - (40%)
Similarity:125/242 - (51%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            ||::|.|    |..|.||..:||..:|     .|.||||    |:.|...:::..::...|||.|
 Frog     1 MSETAPA----PPPAEPAAAKKKQPKK-----GGAKAKK----PAGPSASELIVKAVSASKERSG 52

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLS---------AS 120
            .||.|:||.:.| .|  |.:|....:|..||:.|..|.|.|.||.||||||||:         |:
 Frog    53 VSLAALKKALAAGGY--DVEKNNSRLKLALKALVTKGTLTQVKGSGASGSFKLNKKQLESKEKAA 115

  Fly   121 AKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSK-----KTAVGAADKKPKAKKAVATKKTAEN 180
            .||...|||| |..:|:|.::|.| ..||:..::|     |....|| |.||..||...||.|::
 Frog   116 KKKPAAPKAK-KPAAAKKALKSPK-KPKKVSAAAKSPKKVKKPAKAA-KSPKKPKAAKPKKVAKS 177

  Fly   181 KKTEKAKAKDAKKTGIIKSKPAATK--AKVTAAKPKAVIAKASKAKP 225
            ...:.||.|.||.......||.|||  ||..||||||  |||.||.|
 Frog   178 PAKKAAKPKAAKSPAKKAPKPKATKSPAKAKAAKPKA--AKAKKAAP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33861NP_001027379.1 Linker_histone 46..118 CDD:278939 30/72 (42%)
LOC101732876XP_004912081.2 H15 35..106 CDD:238028 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4781
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.