DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33861 and LOC100497764

DIOPT Version :9

Sequence 1:NP_001027379.1 Gene:His1:CG33861 / 3771736 FlyBaseID:FBgn0053861 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_002941392.3 Gene:LOC100497764 / 100497764 -ID:- Length:212 Species:Xenopus tropicalis


Alignment Length:229 Identity:90/229 - (39%)
Similarity:117/229 - (51%) Gaps:23/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |:::|..|:.:|   |||...||      :.:.|.||||    ||.|...:::..::...|||.|
 Frog     1 MAETAAETAPAP---PPAEAAKK------AAAGGAKAKK----PSGPSAAELIAKAVSASKERSG 52

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.| .|  |.::....:|..||:.|..|.|.|.||.||||||||:....:.|:..|
 Frog    53 VSLAALKKALAAGGY--DVERNNSRLKLALKALVTKGTLTQVKGSGASGSFKLNKKPLESKEKAA 115

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKK-TAVGAADKKPK--AKKAVATKKTAENKKTEKAKAKDA 191
            |.|  .|..|.:....|:||...|.|| ..|.||.|.||  .|.|.|.|..|.....:||....|
 Frog   116 KKK--PAAPKAKKPAAAAKKAPKSPKKPKKVSAAAKSPKKVKKPAKAAKPKAAKSPAKKAAKPKA 178

  Fly   192 KKTGIIKSKPAATKAKVTAAKPKAVIAKASKAKP 225
            .|:....:||.|||:...||||||  |||.||.|
 Frog   179 AKSPAKPTKPKATKSPAKAAKPKA--AKAKKAAP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33861NP_001027379.1 Linker_histone 46..118 CDD:278939 29/72 (40%)
LOC100497764XP_002941392.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.