DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33861 and zgc:163061

DIOPT Version :9

Sequence 1:NP_001027379.1 Gene:His1:CG33861 / 3771736 FlyBaseID:FBgn0053861 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001083000.1 Gene:zgc:163061 / 100037379 ZFINID:ZDB-GENE-070410-132 Length:115 Species:Danio rerio


Alignment Length:119 Identity:44/119 - (36%)
Similarity:64/119 - (53%) Gaps:16/119 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIK 72
            |:.:|.||.||    |..:||::    .|||||.     |...:::..::...|||.|.||.|:|
Zfish     4 TAPAPAAAAPA----KAPRKKSA----AKAKKAG-----PGVGELIVKAVSASKERSGMSLAALK 55

  Fly    73 KYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEK 125
            |.:.|: |  |.:|....:|..:|..|..|.|.|.||.||||||||:...:.::
Zfish    56 KALAASGY--DVEKNNSRVKLAIKGMVTKGVLKQVKGTGASGSFKLNKQQEAQE 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33861NP_001027379.1 Linker_histone 46..118 CDD:278939 29/72 (40%)
zgc:163061NP_001083000.1 H15 30..109 CDD:238028 30/80 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.