powered by:
Protein Alignment His1:CG33807 and AT1G54240
DIOPT Version :9
Sequence 1: | NP_001027290.1 |
Gene: | His1:CG33807 / 3771734 |
FlyBaseID: | FBgn0053807 |
Length: | 256 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_175826.2 |
Gene: | AT1G54240 / 841865 |
AraportID: | AT1G54240 |
Length: | 229 |
Species: | Arabidopsis thaliana |
Alignment Length: | 74 |
Identity: | 21/74 - (28%) |
Similarity: | 31/74 - (41%) |
Gaps: | 5/74 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 SAGTKAKKASATPSH--PPTQQM---VDASIKNLEERGGSSLLAIKKYITATYKCDAQKLAPFIK 91
|.||||:...:|.:. |||.:: :.|..|.:.|.....|.|.:.|..|.......||...|.
plant 145 STGTKAQDTPSTCASFAPPTTEVDPRIIALAKEVAEAEHLELEAKEAYELADKHAQLLKLESNIT 209
Fly 92 KYLKSAVVN 100
..|...::|
plant 210 LQLAVEILN 218
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
His1:CG33807 | NP_001027290.1 |
Linker_histone |
46..118 |
CDD:278939 |
15/60 (25%) |
AT1G54240 | NP_175826.2 |
H15 |
50..115 |
CDD:197772 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11467 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.