DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33807 and AT1G54240

DIOPT Version :9

Sequence 1:NP_001027290.1 Gene:His1:CG33807 / 3771734 FlyBaseID:FBgn0053807 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_175826.2 Gene:AT1G54240 / 841865 AraportID:AT1G54240 Length:229 Species:Arabidopsis thaliana


Alignment Length:74 Identity:21/74 - (28%)
Similarity:31/74 - (41%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SAGTKAKKASATPSH--PPTQQM---VDASIKNLEERGGSSLLAIKKYITATYKCDAQKLAPFIK 91
            |.||||:...:|.:.  |||.::   :.|..|.:.|.....|.|.:.|..|.......||...|.
plant   145 STGTKAQDTPSTCASFAPPTTEVDPRIIALAKEVAEAEHLELEAKEAYELADKHAQLLKLESNIT 209

  Fly    92 KYLKSAVVN 100
            ..|...::|
plant   210 LQLAVEILN 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33807NP_001027290.1 Linker_histone 46..118 CDD:278939 15/60 (25%)
AT1G54240NP_175826.2 H15 50..115 CDD:197772
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.