DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33807 and H1f5

DIOPT Version :9

Sequence 1:NP_001027290.1 Gene:His1:CG33807 / 3771734 FlyBaseID:FBgn0053807 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001102887.1 Gene:H1f5 / 680522 RGDID:1590638 Length:222 Species:Rattus norvegicus


Alignment Length:269 Identity:102/269 - (37%)
Similarity:128/269 - (47%) Gaps:61/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLEERGG 65
            ||::|.|.:.:     ||.|||...:||.. .||...:||:.    ||..:::..::...:||||
  Rat     1 MSETAPAETTA-----PAPVEKSPAKKKTK-KAGAAKRKATG----PPVSELITKAVSASKERGG 55

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.| .|  |.:|....||..|||.|..|.|:||||.||||||||:           
  Rat    56 VSLPALKKALAAGGY--DVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLN----------- 107

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKK- 193
             .||.|.|.|.::||.     |.:..|...||..|||        ||||..|||.|...|.||| 
  Rat   108 -KKVASGEAKPKAKKT-----GAAKAKKPTGATPKKP--------KKTAGAKKTVKKTPKKAKKP 158

  Fly   194 --TGIIKSKPAATKAKVTA---------AKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKP 247
              .|:.|...:..|||..|         |:||||.:|||        |||.|..||   |..|..
  Rat   159 AAAGVKKVTKSPKKAKAAAKPKKATKSPARPKAVKSKAS--------KPKVTKPKA---AKPKAA 212

  Fly   248 KAKTTAAKK 256
            |.|...:||
  Rat   213 KVKKAVSKK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33807NP_001027290.1 Linker_histone 46..118 CDD:278939 34/72 (47%)
H1f5NP_001102887.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 19/63 (30%)
Linker_histone 37..107 CDD:278939 34/71 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..222 64/164 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4648
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X117
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.