DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33807 and H1f2

DIOPT Version :9

Sequence 1:NP_001027290.1 Gene:His1:CG33807 / 3771734 FlyBaseID:FBgn0053807 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_056601.1 Gene:H1f2 / 50708 MGIID:1931526 Length:212 Species:Mus musculus


Alignment Length:258 Identity:103/258 - (39%)
Similarity:126/258 - (48%) Gaps:49/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLEERGG 65
            ||::|   .|:|.|||||  ||...:|||:.......:|||.    ||..:::..::...:||.|
Mouse     1 MSEAA---PAAPAAAPPA--EKAPAKKKAAKKPAGVRRKASG----PPVSELITKAVAASKERSG 56

  Fly    66 SSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||||||||:           
Mouse    57 VSLAALKKALAAAGY--DVEKNNSRIKLGLKSLVSKGILVQTKGTGASGSFKLN----------- 108

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKT 194
             .|..|.|.|.|:||..:.|    :||.| ||| ||||.....||.|.|..|..:|||       
Mouse   109 -KKAASGEAKPQAKKAGAAK----AKKPA-GAA-KKPKKATGAATPKKAAKKTPKKAK------- 159

  Fly   195 GIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSA-KPKKTVKKASVSATAKKPKAKTTAAKK 256
               |...||...||..:..||.|.|..|.|.|..| |||        :|..|..|||..||||
Mouse   160 ---KPAAAAVTKKVAKSPKKAKVTKPKKVKSASKAVKPK--------AAKPKVAKAKKVAAKK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33807NP_001027290.1 Linker_histone 46..118 CDD:278939 33/72 (46%)
H1f2NP_056601.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 20/48 (42%)
H15 34..114 CDD:238028 38/97 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..212 60/150 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10384
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4685
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.