DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33807 and h1-10

DIOPT Version :9

Sequence 1:NP_001027290.1 Gene:His1:CG33807 / 3771734 FlyBaseID:FBgn0053807 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_954970.1 Gene:h1-10 / 322508 ZFINID:ZDB-GENE-030131-1228 Length:192 Species:Danio rerio


Alignment Length:241 Identity:84/241 - (34%)
Similarity:116/241 - (48%) Gaps:59/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLEERGGSSLL 69
            ||...::|..| ||..|||.....|:..|..|.||:.....:   .::|..:|:.|.|:.||||.
Zfish     3 AVVEESAPAPA-PAPAEKKAKPAVAASPAKKKKKKSKGPGKY---SKLVTDAIRTLGEKNGSSLF 63

  Fly    70 AIKKYITATYKCDAQKLAPFIKK----YLKSA----VVNGKLIQTKGKGASGSFKLSASAKKEKD 126
            .|..        :|:|::.|.:|    ||:::    |:|..|:|.||.||:|||||: ..|.||.
Zfish    64 KIYN--------EAKKVSWFDQKNGRMYLRASIRALVLNDTLVQVKGFGANGSFKLN-KKKLEKK 119

  Fly   127 PKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDA 191
            |               ||.||||   ::|||      :||.:||||..|.:|:         |.|
Zfish   120 P---------------KKAASKK---ATKKT------EKPTSKKAVTKKVSAK---------KSA 151

  Fly   192 KKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKK 237
            ||:.:.|..|..|..|...||||    |.:..||..:|| |||..|
Zfish   152 KKSPVKKKTPKKTSVKKATAKPK----KTASKKPKAAAK-KKTKSK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33807NP_001027290.1 Linker_histone 46..118 CDD:278939 27/79 (34%)
h1-10NP_954970.1 Linker_histone 43..109 CDD:366156 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.