DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33807 and hil-1

DIOPT Version :9

Sequence 1:NP_001027290.1 Gene:His1:CG33807 / 3771734 FlyBaseID:FBgn0053807 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_506680.1 Gene:hil-1 / 179993 WormBaseID:WBGene00001852 Length:232 Species:Caenorhabditis elegans


Alignment Length:201 Identity:57/201 - (28%)
Similarity:94/201 - (46%) Gaps:23/201 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HPPTQQMVDASIKNLEERGGSSLLAIKKYITATYKC--DAQKLAPFIKKYLKSAVVNGKLIQTKG 108
            ||....|:..:|:.::...|||..||.|||...|..  :..|:...::..||.||.:|.:.||:|
 Worm    37 HPSYMDMIKGAIQAIDNGTGSSKAAILKYIAQNYHVGENLPKVNNHLRSVLKKAVDSGDIEQTRG 101

  Fly   109 KGASGSFKLSASAKK--EKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPK---- 167
            .||:|||::....:|  :.....::|.:...|:|:.|.....|...:...|:..:.:||.|    
 Worm   102 HGATGSFRMGKECEKNLQVGIPVQTKPMLMLKEVRQKLENISKAEKTKPSTSSMSTNKKGKPIST 166

  Fly   168 -AKKAVATKK-TAENKKTEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAK 230
             .|:.|.:|| :::||...|||:...||.|             .|.|...:|.||:.||...:..
 Worm   167 MKKRGVMSKKRSSKNKMAPKAKSHGLKKKG-------------PATKSSGLVHKAAGAKNEAAPT 218

  Fly   231 PKKTVK 236
            .|..::
 Worm   219 TKMELR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33807NP_001027290.1 Linker_histone 46..118 CDD:278939 27/73 (37%)
hil-1NP_506680.1 Linker_histone 37..111 CDD:278939 27/73 (37%)
PKc_like 96..>140 CDD:304357 13/43 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I6615
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm4774
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.