DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33807 and LOC108645423

DIOPT Version :9

Sequence 1:NP_001027290.1 Gene:His1:CG33807 / 3771734 FlyBaseID:FBgn0053807 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_031748936.1 Gene:LOC108645423 / 108645423 -ID:- Length:230 Species:Xenopus tropicalis


Alignment Length:242 Identity:93/242 - (38%)
Similarity:123/242 - (50%) Gaps:31/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLEERGG 65
            |:::|..|:.:|..|.||..:||..:|     .|.||||    |:.|...:::..::...:||.|
 Frog     1 MTETAAETAPAPPPAEPAAAKKKQPKK-----GGAKAKK----PAGPSAAELIVKAVSASKERSG 56

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLS---------AS 120
            .||.|:||.:.| .|  |.::....:|..||:.|..|.|.|.||.||||||||:         |:
 Frog    57 VSLAALKKALAAGGY--DVERNNSRLKLALKALVTKGTLAQVKGSGASGSFKLNKKPLESKEKAA 119

  Fly   121 AKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSK-----KTAVGAADKKPKAKKAVATKKTAEN 180
            .||...||||....:|.||........||:..::|     |....|| |.||..||...||.|::
 Frog   120 KKKPAAPKAKKPAAAAAKKAPKSPKKPKKVSAAAKSPKKVKKPAKAA-KSPKKPKAAKPKKVAKS 183

  Fly   181 KKTEKAKAKDAKKTGIIKSKPAATK--AKVTAAKPKAVVAKASKAKP 225
            ...:.||.|.||......:||.|||  ||..||||||  |||.||.|
 Frog   184 PAKKAAKPKAAKSPAKKPTKPKATKSPAKAKAAKPKA--AKAKKAAP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33807NP_001027290.1 Linker_histone 46..118 CDD:278939 28/72 (39%)
LOC108645423XP_031748936.1 H15 39..111 CDD:238028 28/73 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4781
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.