DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33642 and CG14518

DIOPT Version :10

Sequence 1:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:171 Identity:36/171 - (21%)
Similarity:73/171 - (42%) Gaps:34/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFWLLWFTNHICLKCEERSFRIKMNEFAVKYKMRDLI------QHIDFRIVNL----NNRSYVNG 63
            :.|:|..:.....:|:           ||.:||.:.:      ..::|.:..|    .|:..:|.
  Fly     6 VIWMLAHSLQPPYQCD-----------AVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNV 59

  Fly    64 EMIVKSDVEDILMHTTMDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNL 128
            :..:...|.|:::...:  .|.:|..|..||....|.|||:: ...|.|.:|..:.||::...|.
  Fly    60 DANLLHPVHDVIVKARL--LKRANGYKPWLYSVSFDGCQFIR-RRNNALIRIVWELFKEYSTINH 121

  Fly   129 SCPLRTNFNYT----LTNWHMDEKDLPPFVPLGTFRTVTEY 165
            :||      |.    :.|:::..:.||..:|.|.:..:.::
  Fly   122 TCP------YVGLQQVKNFYLRSEKLPTPIPTGEYLLMIDW 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33642NP_001027257.1 DUF1091 79..160 CDD:461928 23/84 (27%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 21/81 (26%)

Return to query results.
Submit another query.