DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33642 and CG33640

DIOPT Version :9

Sequence 1:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster


Alignment Length:173 Identity:46/173 - (26%)
Similarity:88/173 - (50%) Gaps:5/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLWFTNHI-CLKCEERSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVEDIL 75
            ||.|::.| |..|....|   ::.|......|||.......:....||||::|.|::...|.|:.
  Fly     8 LLVFSSLINCSLCAHVVF---VDHFTFTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDLT 69

  Fly    76 MHTTMDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNFNYTL 140
            :.::||..: ..:.:::||:.:|:.|..|...::|...::...::.:.::....|||:.||||:|
  Fly    70 LTSSMDITR-PQRPELRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSL 133

  Fly   141 TNWHMDEKDLPPFVPLGTFRTVTEYFTQDRLALRIVTQGKVLS 183
            ...::||..||..:|..|:|....:..:.:|...:...|::||
  Fly   134 HRAYIDEAMLPDLLPECTYRLKMSFKHKSKLLAHMQIDGRLLS 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 22/80 (28%)
CG33640NP_001027255.2 DUF1091 73..154 CDD:284008 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007613
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.