DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33642 and CG33757

DIOPT Version :10

Sequence 1:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster


Alignment Length:168 Identity:29/168 - (17%)
Similarity:65/168 - (38%) Gaps:32/168 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LKCEERSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVEDILMHTTMDFWKT 85
            |.|:.::.....|..:::::          ::..:||                  :|..::.:|.
  Fly    38 LLCKIKAINRYRNSISIQFR----------QLRTVNN------------------VHMRLELFKR 74

  Fly    86 SNQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHI-HGNLSCPLRTNFNYTLTNWHMD-EK 148
            :|..:..||:...:.|.|| :...|.:..:..:..|.:| ..|.:||.:.|.....|:...| ||
  Fly    75 ANGWRPFLYNISFNLCDFL-SKRNNVIVSLGYEYLKPYIPMTNYTCPFKKNHLIKCTDLEFDIEK 138

  Fly   149 DLPPF-VPLGTFRTVTEYFTQDRLALRIVTQGKVLSYK 185
            ....| :..|.:.....:..|.::.|.:....:..:|:
  Fly   139 FRVRFPIETGEYALQLSFIVQRKVTLTLNGSAEYYNYR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33642NP_001027257.1 DUF1091 79..160 CDD:461928 20/83 (24%)
CG33757NP_001027398.1 DUF1091 67..152 CDD:461928 20/85 (24%)

Return to query results.
Submit another query.